Recombinant Phytophthora cryptogea Beta-elicitin cryptogein | CSB-EP322784PJL

(No reviews yet) Write a Review
SKU:
CSB-EP322784PJL
Availability:
3 - 7 Working Days
  • Recombinant Phytophthora cryptogea Beta-elicitin cryptogein
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP322784PJL could indicate that this peptide derived from E.coli-expressed Phytophthora cryptogea N/A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP322784PJL could indicate that this peptide derived from E.coli-expressed
$422.40 - $2,042.40

Description

Recombinant Phytophthora cryptogea Beta-elicitin cryptogein | CSB-EP322784PJL | Cusabio

Alternative Name(s): CRY

Gene Names: N/A

Research Areas: Others

Organism: Phytophthora cryptogea

AA Sequence: TACTATQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLMCASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-118aa

Sequence Info: Full Length of Mature Protein

MW: 17.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Induces local and distal defense responses in plants from the solanaceae and cruciferae families. Elicits leaf necrosis and causes the accumulation of pathogenesis-related proteins. Might interact with the lipidic molecules of the plasma membrane.

Reference: "The 1.45 A resolution structure of the cryptogein-cholesterol complex: a close-up view of a sterol carrier protein (SCP) active site." Lascombe M.B., Ponchet M., Venard P., Milat M.L., Blein J.P., Prange T. Acta Crystallogr. D Biol. Crystallogr. 58:1442-1447(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Induces local and distal defense responses (incompatible hypersensitive reaction) in plants from the solanaceae and cruciferae families. Elicits leaf necrosis and causes the accumulation of pathogenesis-related proteins. Might interact with the lipidic molecules of the plasma membrane.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Elicitin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15570

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose