Recombinant Phoneutria nigriventer Delta-ctenitoxin-Pn1a (PNTx4) | CSB-YP349440EUV

(No reviews yet) Write a Review
SKU:
CSB-YP349440EUV
Availability:
25 - 35 Working Days
  • Recombinant Phoneutria nigriventer Delta-ctenitoxin-Pn1a (PNTx4)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Phoneutria nigriventer Delta-ctenitoxin-Pn1a (PNTx4) | CSB-YP349440EUV | Cusabio

Alternative Name(s): Insecticidal neurotoxin Tx4(6-1) Short name:PNTx4(6-1)

Gene Names: PNTx4

Research Areas: Others

Organism: Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)

AA Sequence: CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 35-82aa

Sequence Info: Full Length of Mature Protein

MW: 7.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice.

Reference: "Molecular cloning of cDNAs encoding insecticidal neurotoxic peptides from the spider Phoneutria nigriventer."Penaforte C.L., Prado V.F., Prado M.A.M., Romano-Silva M.A., Guimaraes P.E.M., De Marco L., Gomez M.V., Kalapothakis E.Toxicon 38:1443-1449(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Spider toxin Tx2 family

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P59368

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose