Recombinant Phleum pRatense Pollen allergen Phl p 2 (PHLPII) | CSB-EP337346GUQ

Recombinant Phleum pRatense Pollen allergen Phl p 2 (PHLPII) | CSB-EP337346GUQ | Cusabio

Alternative Name(s): Allergen Phl p II Allergen: Phl p 2

Gene Names: PHLPII

Research Areas: Allergen

Organism: Phleum pratense (Common timothy)

AA Sequence: VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 27-122aa

Sequence Info: Full Length of Mature Protein

MW: 26.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Molecular characterization of Phl p II, a major timothy grass (Phleum pratense) pollen allergen."Dolecek C., Vrtala S., Laffer S., Steinberger P., Kraft D., Scheiner O., Valenta R.FEBS Lett. 335:299-304(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Expansin family, Expansin B subfamily

Tissue Specificity: Pollen specific.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P43214

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A