Cusabio Virus & Bacteria Recombinants
Recombinant Phanerochaete chrysosporium Cellobiose dehydrogenase (CDH-1) , partial | CSB-EP312474EUK
- SKU:
- CSB-EP312474EUK
- Availability:
- 13 - 23 Working Days
Description
Recombinant Phanerochaete chrysosporium Cellobiose dehydrogenase (CDH-1) , partial | CSB-EP312474EUK | Cusabio
Alternative Name(s): Cellobiose-quinone oxidoreductase
Gene Names: CDH-1
Research Areas: Signal Transduction
Organism: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)
AA Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 19-208aa
Sequence Info: Partial
MW: 36.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.
Reference: "Cloning of a cDNA encoding cellobiose dehydrogenase, a hemoflavoenzyme from Phanerochaete chrysosporium."Li B., Nagalla S.R., Renganathan V.Appl. Environ. Microbiol. 62:1329-1335(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: GMC oxidoreductase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q01738
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A