Recombinant Paracoccus denitrificans Nitrous-oxide reductase (nosZ) | CSB-EP703536PBZ

Recombinant Paracoccus denitrificans Nitrous-oxide reductase (nosZ) | CSB-EP703536PBZ | Cusabio

Alternative Name(s): N(2)OR N2O reductase

Gene Names: nosZ

Research Areas: Others

Organism: Paracoccus denitrificans

AA Sequence: ASGDGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTATVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 58-553aa

Sequence Info: Full Length of Mature Protein

MW: 71.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Nitrous-oxide reductase is part of a bacterial respiratory system which is activated under anaerobic conditions in the presence of nitrate or nitrous oxide.

Reference: "Sequence and expression of the gene encoding the respiratory nitrous-oxide reductase from Paracoccus denitrificans. New and conserved structural and regulatory motifs."Hoeren F.U., Berks B.C., Ferguson S.J., McCarthy J.E.G.Eur. J. Biochem. 218:49-57(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Nitrous-oxide reductase is part of a bacterial respiratory system which is activated under anaerobic conditions in the presence of nitrate or nitrous oxide.

Involvement in disease:

Subcellular Location: Periplasm

Protein Families: NosZ family; Cytochrome c oxidase subunit 2 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q51705

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A