Recombinant Paracoccus denitrificans Electron transfer flavoprotein-ubiquinone oxidoreductase | CSB-EP007846PBZ

Recombinant Paracoccus denitrificans Electron transfer flavoprotein-ubiquinone oxidoreductase | CSB-EP007846PBZ | Cusabio

Alternative Name(s): Electron-transferring-flavoprotein dehydrogenase (ETF dehydrogenase ) (ETF-QO) (ETF-ubiquinone oxidoreductase)

Gene Names: N/A

Research Areas: Others

Organism: Paracoccus denitrificans

AA Sequence: SDIGGSMDYDVVIVGAGGAGLSAAILKQVNP

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 1-31aa

Sequence Info: Full Length

MW: 18.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Accepts electrons from ETF and reduces ubiquinone.

Reference: "Molecular cloning and expression of a cDNA encoding human electron transfer flavoprotein-ubiquinone oxidoreductase." Goodman S.I., Axtell K.M., Bindoff L.A., Beard S.E., Gill R.E., Frerman F.E. Eur. J. Biochem. 219:277-286(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Accepts electrons from ETF and reduces ubiquinone.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55932

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A