Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial | CSB-EP771253EQVa2

(No reviews yet) Write a Review
SKU:
CSB-EP771253EQVa2
Availability:
13 - 23 Working Days
  • Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial | CSB-EP771253EQVa2 | Cusabio

Alternative Name(s): Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3

Gene Names: LTB

Research Areas: Others

Organism: Pan troglodytes (Chimpanzee)

AA Sequence: QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 49-244aa

Sequence Info: Extracellular Domain

MW: 36.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the mbrane anchor for the attachment of the heterotrimeric complex to the cell surface .

Reference: Comparative sequencing of human and chimpanzee MHC class I regions unveils insertions/deletions as the major path to genomic divergence.Anzai T., Shiina T., Kimura N., Yanagiya K., Kohara S., Shigenari A., Yamagata T., Kulski J.K., Naruse T.K., Fujimori Y., Fukuzumi Y., Yamazaki M., Tashiro H., Iwamoto C., Umehara Y., Imanishi T., Meyer A., Ikeo K. , Gojobori T., Bahram S., Inoko H.Proc. Natl. Acad. Sci. U.S.A. 100:7708-7713(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface (By similarity).

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families: Tumor necrosis factor family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q862Z7

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose