Recombinant Oxyopes takobius Oxyopinin-4a | CSB-EP520732OGA

Recombinant Oxyopes takobius Oxyopinin-4a | CSB-EP520732OGA | Cusabio

Alternative Name(s): Oxt-4a

Gene Names: N/A

Research Areas: Others

Organism: Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)

AA Sequence: GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 48-77aa

Sequence Info: Full Length of Mature Protein

MW: 19.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 µM) and B.subtilis (MIC=0.5 µM) as well as Gram-negative bacteria P.fluorescens (MIC=1 µM) and E.coli (MIC=0.5 µM). Has hemolytic activity against human erythrocytes (EC(50)=7 µM)

Reference: "Novel lynx spider toxin shares common molecular architecture with defense peptides from frog skin."Dubovskii P.V., Vassilevski A.A., Samsonova O.V., Egorova N.S., Kozlov S.A., Feofanov A.V., Arseniev A.S., Grishin E.V.FEBS J. 278:4382-4393(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 uM) and B.subtilis (MIC=0.5 uM) as well as Gram-negative bacteria P.fluorescens (MIC=1 uM) and E.coli (MIC=0.5 uM). Has hemolytic activity against human erythrocytes (EC(50)=7 uM).

Involvement in disease:

Subcellular Location: Secreted, Target cell membrane

Protein Families:

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: F8J4S0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A