Recombinant Ornithodoros moubata Tick anticoagulant peptide | CSB-EP325525OCK

(No reviews yet) Write a Review
SKU:
CSB-EP325525OCK
Availability:
3 - 7 Working Days
  • Recombinant Ornithodoros moubata Tick anticoagulant peptide
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $1,365.60

Description

Recombinant Ornithodoros moubata Tick anticoagulant peptide | CSB-EP325525OCK | Cusabio

Alternative Name(s): ; Tick anticoagulant peptide; TAP

Gene Names: N/A

Research Areas: Others

Organism: Ornithodoros moubata (Soft tick) (Argasid tick)

AA Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-60aa

Sequence Info: Full Length

MW: 27 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.

Reference: "NMR solution structure of the recombinant tick anticoagulant protein (rTAP), a factor Xa inhibitor from the tick Ornithodoros moubata." Antuch W., Guntert P., Billeter M., Hawthorne T., Grossenbacher H., Wuethrich K. FEBS Lett. 352:251-257(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17726

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose