Recombinant Oncorhynchus mykiss Transforming growth factor beta-1 (TGFB1) | CSB-YP023446OEI

Recombinant Oncorhynchus mykiss Transforming growth factor beta-1 (TGFB1) | CSB-YP023446OEI | Cusabio

Alternative Name(s): Short name: TGF-beta-1

Gene Names: TGFB1

Research Areas: Signal Transduction

Organism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

AA Sequence: QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 271-382aa

Sequence Info: Full Length of Mature Protein

MW: 15 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.

Reference: "Isolation of the first piscine transforming growth factor beta gene: analysis reveals tissue specific expression and a potential regulatory sequence in rainbow trout (Oncorhynchus mykiss)."Hardie L.J., Laing K.J., Daniels G.D., Grabowski P.S., Cunningham C., Secombes C.J.Cytokine 10:555-563(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity: Expressed in blood leucocytes, kidney macrophages, brain, gill and spleen but not in liver.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O93449

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A