Recombinant Oncorhynchus mykiss Myelin proteolipid protein (plp), partial | CSB-EP018202OEI

Recombinant Oncorhynchus mykiss Myelin proteolipid protein (plp), partial | CSB-EP018202OEI | Cusabio

Alternative Name(s): DM20Lipophilin

Gene Names: plp

Research Areas: Others

Organism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

AA Sequence: PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 150-218aa

Sequence Info: Partial

MW: 11.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.

Reference: Cloning and expression of the proteolipid protein DM20 cDNA from the brain of the rainbow trout, Oncorhynchus mykiss.Tang S., Panno J.P., McKeown B.A.Brain Res. Mol. Brain Res. 41:134-139(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: Myelin proteolipid protein family

Tissue Specificity: Central nervous system. Highest levels in spinal cord and medulla oblongata.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P79826

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A