Recombinant Nostoc sp. Protein patA (patA) | CSB-EP336525NHR

Recombinant Nostoc sp. Protein patA (patA) | CSB-EP336525NHR | Cusabio

Alternative Name(s): PAT-1

Gene Names: patA

Research Areas: Others

Organism: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

AA Sequence: MKTLPITRYRFFQKIQPLSLLKKITGKTITGCLQVFSTSGTWSIYVEEGKLIYACYSERMFEPLYRHLGNLSPQIATLPKEINEQLRAIFETGIENQAIPNPDYLAICWLVNQKYISSSQAAVLIEQLALEVVESFLMLEEGSYEFIPESFLDDLPKFCYLNVRLLVEQCQQHGRVPEAFRREASSQEISSSTEHNQIPVNNRRSTKFTSPPHTQPKPEPRLPQINTNKSTEYSKRYASQPNTVNHGYSQTSATSTDKKIYTIFCIDENPIVLNNIKNFLDDQIFAVIGVTDSLKALMEILCTKPDIILINVDMPDLDGYELCSLLRKHSYFKNTPVIMVTEKAGLVDRARAKIVRASGHLTKPFNQGDLLKVIFKHIT

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-379aa

Sequence Info: Full Length

MW: 50.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Controls heterocyst pattern formation. Required for the differentiation of intercalary heterocysts but not for terminal heterocysts.

Reference: "Mutations in genes patA and patL of Anabaena sp. strain PCC 7120 result in similar phenotypes, and the proteins encoded by those genes may interact." Liu J., Wolk C.P. J. Bacteriol. 193:6070-6074(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Controls heterocyst pattern formation. Required for the differentiation of intercalary heterocysts but not for terminal heterocysts.

Involvement in disease:

Subcellular Location: Cell septum

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P39048

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A