Recombinant Neurospora crassa Cyanovirin-N homolog (NCU05495) | CSB-EP742424NHA

Recombinant Neurospora crassa Cyanovirin-N homolog (NCU05495) | CSB-EP742424NHA | Cusabio

Alternative Name(s): NCU05495Cyanovirin-N homolog; CV-N homolog

Gene Names: NCU05495

Research Areas: Others

Organism: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

AA Sequence: MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-111aa

Sequence Info: Full Length

MW: 16.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Mannose-binding lectin.

Reference: "A designed chimeric cyanovirin-N homolog lectin: structure and molecular basis of sucrose binding." Koharudin L.M., Furey W., Gronenborn A.M. Proteins 77:904-915(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mannose-binding lectin.

Involvement in disease:

Subcellular Location:

Protein Families: Cyanovirin-N family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q7S6U4

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A