Recombinant Neosartorya fumigata Vacuolar protease A (pep2) | CSB-EP523645NGS

Recombinant Neosartorya fumigata Vacuolar protease A (pep2) | CSB-EP523645NGS | Cusabio

Alternative Name(s): Aspartic endopeptidase pep2 (Aspartic protease pep2)

Gene Names: pep2

Research Areas: Others

Organism: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

AA Sequence: SRHDVLVDNFLNAQYFSEISLGTPPQKFKVVLDTGSSNLWVPGSDCSSIACFLHNKYDSSASSTYKANGTEFAIKYGSGELSGFVSQDTLQIGDLKVVKQDFAEATNEPGLAFAFGRFDGILGLGYDTISVNKIVPPFYNMLDQGLLDEPVFAFYLGDTNKEGDNSEASFGGVDKNHYTGELTKIPLRRKAYWEVDFDAIALGDNVAELENTGIILDTGTSLIALPSTLADLLNKEIGAKKGFTGQYSIECDKRDSLPDLTFTLAGHNFTIGPYDYTLEVQGSCISSFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNNAVGLAKAK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 71-398aa

Sequence Info: Full Length of Mature Protein

MW: 39.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Vacuolar aspartic endopeptidase which is probably also secreted and contributes to virulence.

Reference: "Genes and molecules involved in Aspergillus fumigatus virulence." Rementeria A., Lopez-Molina N., Ludwig A., Vivanco A.B., Bikandi J., Ponton J., Garaizar J. Rev. Iberoam. Micol. 22:1-23(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Vacuolar aspartic endopeptidase which is probably also secreted and contributes to virulence.

Involvement in disease:

Subcellular Location: Vacuole lumen, Secreted

Protein Families: Peptidase A1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O42630

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A