Recombinant Neosartorya fumigata Peroxiredoxin Asp f3 (aspf3) | CSB-EP525004NGS

(No reviews yet) Write a Review
SKU:
CSB-EP525004NGS
Availability:
13 - 23 Working Days
  • Recombinant Neosartorya fumigata Peroxiredoxin Asp f3 (aspf3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Neosartorya fumigata Peroxiredoxin Asp f3 (aspf3) | CSB-EP525004NGS | Cusabio

Alternative Name(s): Peroxisomal membrane protein pmp20 Thioredoxin reductase Allergen: Asp f 3

Gene Names: aspf3

Research Areas: Allergen

Organism: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

AA Sequence: MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-168aa

Sequence Info: Full Length

MW: 34.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Allergens of Aspergillus fumigatus and Candida boidinii share IgE-binding epitopes."Hemmann S., Blaser K., Crameri R.Am. J. Respir. Crit. Care Med. 156:1956-1962(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Required for virulence.

Involvement in disease:

Subcellular Location:

Protein Families: Peroxiredoxin family, Prx5 subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43099

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose