Recombinant Naja mossambica Cytotoxin 5 | CSB-EP329557NAH

(No reviews yet) Write a Review
SKU:
CSB-EP329557NAH
Availability:
13 - 23 Working Days
  • Recombinant Naja mossambica Cytotoxin 5
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Naja mossambica Cytotoxin 5 | CSB-EP329557NAH | Cusabio

Alternative Name(s): CTX M51 CTX V

Gene Names: N/A

Research Areas: Others

Organism: Naja mossambica (Mozambique spitting cobra)

AA Sequence: LKCKKLIPLFSKTCPEGKNLCYKMTMRLAPKVPVKRGCIDVCPKSSFLVKYECCDTDRCN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-60aa

Sequence Info: Full Length

MW: 10.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Shows cytolytic activity on many different cells by forming pore in lipid membranes. In vivo, increases heart rate or kills the animal by cardiac arrest. In addition, it binds to heparin with high affinity, interacts with Kv channel-interacting protein 1 (KCNIP1) in a calcium-independent manner, and binds to integrin alpha-V/beta-3 (ITGAV/ITGB3) with moderate affinity.

Reference: "Are interactions with phospholipids responsible for pharmacological activities of cardiotoxins?" Bougis P.E., Tessier M., van Rietschoten J., Rochat H., Faucon J.F., Dufourcq J. Mol. Cell. Biochem. 55:49-64(1983)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Shows cytolytic activity on many different cells by forming pore in lipid membranes

Involvement in disease:

Subcellular Location: Secreted, Target cell membrane

Protein Families: Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25517

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose