Recombinant Naja atra Cytotoxin 4 | CSB-EP355645NFG

Recombinant Naja atra Cytotoxin 4 | CSB-EP355645NFG | Cusabio

Alternative Name(s): Cardiotoxin A4 Short name: CTX A4 Cardiotoxin analog IV Short name: CTX IV

Gene Names: N/A

Research Areas: Others

Organism: Naja atra (Chinese cobra)

AA Sequence: RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-81aa

Sequence Info: Full Length of Mature Protein

MW: 22.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.

Reference: "Genomic structures of cardiotoxin 4 and cobrotoxin from Naja naja atra (Taiwan cobra)."Chang L.-S., Lin J., Chou Y.-C., Hong E.Biochem. Biophys. Res. Commun. 239:756-762(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.

Involvement in disease:

Subcellular Location: Secreted, Target cell membrane

Protein Families: Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01443

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A