Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083 (MPN_083), partial | CSB-EP303444MLW

(No reviews yet) Write a Review
SKU:
CSB-EP303444MLW
Availability:
13 - 23 Working Days
  • Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083 (MPN_083), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083 (MPN_083), partial | CSB-EP303444MLW | Cusabio

Alternative Name(s): Uncharacterized lipoprotein MPN_083

Gene Names: MPN_083

Research Areas: Microbiology

Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)

AA Sequence: CSFKDYIPTPSFRKDFSTENNFVKNKVPGKDDIYSKFYDLTFSLNFVNNQAQEFGTGWLIDWKGDENKNLSKNKEGQTASQTRSSSEQTTDQDANLFTAYIATNLHVADGLKNDQDYAPYNKDGWGQPYPYQQKTQSFLLGKYTKPNVQLVKTNYEKPEDAVIEQKLKEDSLLFIQTSTLPKTAYAAIDPVNFSYNPTRTNGFWTAGKYNVYNGGNSIGNY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-242aa

Sequence Info: Partial

MW: 41.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor

Protein Families: MG067/MG068/MG395 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P75610

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose