Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase (cyp125) | CSB-EP351308MVZ

(No reviews yet) Write a Review
SKU:
CSB-EP351308MVZ
Availability:
13 - 23 Working Days
  • Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase (cyp125)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase (cyp125) | CSB-EP351308MVZ | Cusabio

Alternative Name(s): Cholest-4-en-3-one 26-monooxygenaseCytochrome P450 125Steroid C27-monooxygenase

Gene Names: cyp125

Research Areas: Others

Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

AA Sequence: MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-433aa

Sequence Info: Full Length

MW: 64.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the C-27 hydroxylation of cholest-4-en-3-one and cholesterol and subsequently oxidizes the alcohol of the former to the cholest-4-en-3-one-27-oic acid via the aldehyde intermediate. Not required to incorporate the cholesterol side-chain carbon atoms into cellular lipids.

Reference: Reverse type I inhibitor of Mycobacteriumtuberculosis CYP125A1.Ouellet H., Kells P.M., Ortiz de Montellano P.R., Podust L.M.Bioorg. Med. Chem. Lett. 21:332-337(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the utilization of cholesterol as the sole carbon and energy source by degrading the side chain during infection

Involvement in disease:

Subcellular Location:

Protein Families: Cytochrome P450 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P9WPP1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose