Recombinant Mycobacterium tuberculosis Signal peptidase I (lepB), partial | CSB-EP604637MVZ

(No reviews yet) Write a Review
SKU:
CSB-EP604637MVZ
Availability:
13 - 23 Working Days
  • Recombinant Mycobacterium tuberculosis Signal peptidase I (lepB), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Mycobacterium tuberculosis Signal peptidase I (lepB), partial | CSB-EP604637MVZ | Cusabio

Alternative Name(s): Leader peptidase I

Gene Names: lepB

Research Areas: Others

Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

AA Sequence: RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 88-294aa

Sequence Info: Extracellular Domain

MW: 38.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.Kelkar D.S., Kumar D., Kumar P., Balakrishnan L., Muthusamy B., Yadav A.K., Shrivastava P., Marimuthu A., Anand S., Sundaram H., Kingsbury R., Harsha H.C., Nair B., Prasad T.S., Chauhan D.S., Katoch K., Katoch V.M., Kumar P. , Chaerkady R., Ramachandran S., Dash D., Pandey A.Mol. Cell. Proteomics 10:M111.011627-M111.011627(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type II membrane protein

Protein Families: Peptidase S26 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P9WKA1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose