Recombinant Mycobacterium tuberculosis Phosphate-binding protein PstS 1 (pstS1), partial | CSB-RP149194Ba

(No reviews yet) Write a Review
SKU:
CSB-RP149194Ba
Availability:
13 - 23 Working Days
  • Recombinant Mycobacterium tuberculosis Phosphate-binding protein PstS 1 (pstS1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Mycobacterium tuberculosis Phosphate-binding protein PstS 1 (pstS1), partial | CSB-RP149194Ba | Cusabio

Alternative Name(s): Antigen Ag78 Protein antigen B Short name: PAB

Gene Names: pstS1

Research Areas: Others

Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

AA Sequence: CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-373aa

Sequence Info: Partial

MW: 39.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Part of the ABC transporter complex PstSACB involved in phosphate import.

Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Part of the ABC transporter complex PstSACB involved in phosphate import.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor

Protein Families: PstS family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P9WGU0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose