Recombinant Mycobacterium tuberculosis Large-conductance mechanosensitive channel (mscL), partial | CSB-EP358693MVZ1b1

Recombinant Mycobacterium tuberculosis Large-conductance mechanosensitive channel (mscL), partial | CSB-EP358693MVZ1b1 | Cusabio

Alternative Name(s): /

Gene Names: mscL

Research Areas: Others

Organism: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

AA Sequence: VLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 91-151aa

Sequence Info: Partial

MW: 11.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Channel that opens in response to stretch forces in the membrane lipid bilayer. The force required to trigger channel opening depends on the nature of the membrane lipids; the presence of phosphatidylinositol enhances mechanosensitivity of the channel. May participate in the regulation of osmotic pressure changes within the cell.

Reference: "Structure of the MscL homolog from Mycobacterium tuberculosis: a gated mechanosensitive ion channel." Chang G., Spencer R.H., Lee A.T., Barclay M.T., Rees D.C. Science 282:2220-2226(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P9WJN5

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A