Recombinant Mumps virus Hemagglutinin-neuraminidase (HN), partial | CSB-EP319979MJJ2

Recombinant Mumps virus Hemagglutinin-neuraminidase (HN), partial | CSB-EP319979MJJ2 | Cusabio

Alternative Name(s): HN; Hemagglutinin-neuraminidase; EC 3.2.1.18

Gene Names: HN

Research Areas: Epigenetics and Nuclear Signaling

Organism: Mumps virus (strain Miyahara vaccine) (MuV)

AA Sequence: YATHDFSIGHPLNMPSFIPTATSPNGCTRIPSFSLGKTHWCYTHNVINANCKDHTSSNQYISMGILVQTASGYPMFKTLKIQYLSDGLNRKSCSIATVPDGCAMYCYVSTQLETDDYAGSSPPTQKLTLLFYNDTVTERTISPTGLEGNWATLVPGVGSGIYFENKLIFPAYGGVLPNSSLGVKSAREFFRPVNPYNPCSGPQQDLDQR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 152-360aa

Sequence Info: Partial

MW: 27.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion.Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.

Reference: "Molecular cloning and sequence analysis of the mumps virus gene encoding the L protein and the trailer sequence." Okazaki K., Tanabayashi K., Takeuchi K., Hishiyama M., Okazaki K., Yamada A. Virology 188:926-930(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P11235

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A