Recombinant Mouse Vomeronasal secretory protein 1 (Lcn3) | CSB-EP730794MO

Recombinant Mouse Vomeronasal secretory protein 1 (Lcn3) | CSB-EP730794MO | Cusabio

Alternative Name(s): Lipocalin-3 Vomeronasal secretory protein I Short name: VNSP I

Gene Names: Lcn3

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: QDSSFLAFNNGNFSGKWFLKALVSEDDIPINKVSPMLILVLNNGDIELSITHMIYDQCLEVTTILEKTDVPGQYLAFEGKTHLQVQLSSVKGHYMLYCDGEIEGMRFLMTQLIGRDPQENLEALEEFKVFTQIKGLVAENLVILEQMEKCEPESFYELPSRPSE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 19-182aa

Sequence Info: Full Length of Mature Protein

MW: 34.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transport of lipophilic molecules, possible pheromone-carrier.

Reference: "Possible pheromone-carrier function of two lipocalin proteins in the vomeronasal organ."Miyawaki A., Matsushita F., Ryo Y., Mikoshiba K. EMBO J. 13:5835-5842(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transport of lipophilic molecules, possible pheromone-carrier.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Calycin superfamily, Lipocalin family

Tissue Specificity: Specifically expressed in vomeronasal and posterior glands of the nasal septum, the ducts of which open into the lumen of the vomeronasal organ.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q62471

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A