Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial | CSB-EP011930MO

(No reviews yet) Write a Review
SKU:
CSB-EP011930MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial | CSB-EP011930MO | Cusabio

Alternative Name(s): Janus kinase 1 Short name: JAK-1

Gene Names: Jak1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVKTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALL

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 848-1152aa

Sequence Info: Partial

MW: 39.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor. ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Reference: "Molecular cloning of the murine JAK1 protein tyrosine kinase and its expression in the mouse central nervous system."Yang X., Chung D., Cepko C.L.J. Neurosci. 13:3006-3017(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor.

Involvement in disease:

Subcellular Location: Endomembrane system, Peripheral membrane protein

Protein Families: Protein kinase superfamily, Tyr protein kinase family, JAK subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P52332

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose