Cusabio Mouse Recombinants
Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial | CSB-EP011930MO
- SKU:
- CSB-EP011930MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial | CSB-EP011930MO | Cusabio
Alternative Name(s): Janus kinase 1 Short name: JAK-1
Gene Names: Jak1
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVKTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALL
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 848-1152aa
Sequence Info: Partial
MW: 39.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor. ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
Reference: "Molecular cloning of the murine JAK1 protein tyrosine kinase and its expression in the mouse central nervous system."Yang X., Chung D., Cepko C.L.J. Neurosci. 13:3006-3017(1993)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor.
Involvement in disease:
Subcellular Location: Endomembrane system, Peripheral membrane protein
Protein Families: Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P52332
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: STRING
OMIM Database Link: N/A