null

Recombinant Mouse TSC22 domain family protein 4 (Tsc22d4) | CSB-YP887652MO

(No reviews yet) Write a Review
SKU:
CSB-YP887652MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse TSC22 domain family protein 4 (Tsc22d4)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €1,345.00
Frequently bought together:

Description

Recombinant Mouse TSC22 domain family protein 4 (Tsc22d4) | CSB-YP887652MO | Cusabio

Alternative Name(s): TSC22-related-inducible leucine zipper protein 2 Thg-1pit

Gene Names: Tsc22d4

Research Areas: Epigenetics and Nuclear Signaling

Organism: Mus musculus (Mouse)

AA Sequence: MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTGGRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAKVETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRALASPEQLAQLPSSGLPRLGPSAPNGPSI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-387aa

Sequence Info: Full Length

MW: 42 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transcriptional repressor.

Reference: "Expression screening for Lhx3 downstream genes identifies Thg-1pit as a novel mouse gene involved in pituitary development."Fiorenza M.T., Mukhopadhyay M., Westphal H.Gene 278:125-130(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcriptional repressor.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: TSC-22/Dip/Bun family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9EQN3

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose