Recombinant Mouse Transmembrane protease serine 4 (Tmprss4), partial | CSB-EP844988MO

Recombinant Mouse Transmembrane protease serine 4 (Tmprss4), partial | CSB-EP844988MO | Cusabio

Alternative Name(s): Channel-activating protease 2 ;mCAP2

Gene Names: Tmprss4

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 52-435aa

Sequence Info: Extracellular Domain

MW: 57.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probable protease. Ses to be capable of activating ENaC.

Reference: Synergistic activation of ENaC by three membrane-bound channel-activating serine proteases (mCAP1, mCAP2, and mCAP3) and serum- and glucocorticoid-regulated kinase (Sgk1) in Xenopus oocytes.Vuagniaux G., Vallet V., Jaeger N.F., Hummler E., Rossier B.C.J. Gen. Physiol. 120:191-201(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probable protease. Seems to be capable of activating ENaC.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families: Peptidase S1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8VCA5

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A