Recombinant Mouse Translocator protein (Tspo) | CSB-CF025168MO

Recombinant Mouse Translocator protein (Tspo) | CSB-CF025168MO | Cusabio

Alternative Name(s): Mitochondrial benzodiazepine receptor (PKBS) (Peripheral-type benzodiazepine receptor) (PBR) (Bzrp) (Mbr)

Gene Names: Tspo

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-169aa

Sequence Info: Full Length

MW: 21.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. According to some reports, it is not required for steroid hormone biosynthesis.

Reference: "High-throughput sequence identification of gene coding variants within alcohol-related QTLs." Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J., Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M. Mamm. Genome 12:657-663(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P50637

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A