Recombinant Mouse Thyroid hormone-inducible hepatic protein (Thrsp) | CSB-EP726789MO

Recombinant Mouse Thyroid hormone-inducible hepatic protein (Thrsp) | CSB-EP726789MO | Cusabio

Alternative Name(s): Spot 14 protein Short name: S14 Short name: SPOT14

Gene Names: Thrsp

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-150aa

Sequence Info: Full Length

MW: 33.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB

Reference: "Cloning and initial characterization of human and mouse Spot 14 genes."Grillasca J.-P., Gastaldi M., Khiri H., Dace A., Peyrol N., Reynier P., Torresani J., Planells R.FEBS Lett. 401:38-42(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB (By similarity).

Involvement in disease:

Subcellular Location: Nucleus, Cytoplasm

Protein Families: SPOT14 family

Tissue Specificity: Mainly expressed in tissues that synthesize triglycerides.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q62264

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A