Recombinant Mouse Thymosin beta-10 (Tmsb10) | CSB-EP765096MO

(No reviews yet) Write a Review
SKU:
CSB-EP765096MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Thymosin beta-10 (Tmsb10)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Mouse Thymosin beta-10 (Tmsb10) | CSB-EP765096MO | Cusabio

Alternative Name(s): Tmsb10;Ptmb10

Gene Names: Tmsb10

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-44aa

Sequence Info: Full Length of Mature Protein

MW: 17.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).

Reference: "Fetal and trophoblast PI3K p110alpha have distinct roles in regulating resource supply to the growing fetus in mice." Lopez-Tello J., Perez-Garcia V., Khaira J., Kusinski L.C., Cooper W.N., Andreani A., Grant I., Fernandez de Liger E., Lam B.Y., Hemberger M., Sandovici I., Constancia M., Sferruzzi-Perri A.N. Elife 8:0-0(2019)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6ZWY8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose