Recombinant Mouse Thy-1 membrane glycoprotein (Thy1) | CSB-EP023525MO

Recombinant Mouse Thy-1 membrane glycoprotein (Thy1) | CSB-EP023525MO | Cusabio

Alternative Name(s): Thy-1 antigen CD_antigen: CD90

Gene Names: Thy1

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-131aa

Sequence Info: Full Length of Mature Protein

MW: 28.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Reference: "A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189(2010).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01831

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A