Recombinant Mouse Thioredoxin reductase-like selenoprotein T (Selenot) | CSB-EP350436MO

(No reviews yet) Write a Review
SKU:
CSB-EP350436MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Thioredoxin reductase-like selenoprotein T (Selenot)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Thioredoxin reductase-like selenoprotein T (Selenot) | CSB-EP350436MO | Cusabio

Alternative Name(s): Selenot; Selt; Thioredoxin reductase-like selenoprotein T; SelT; EC 1.8.1.9

Gene Names: Selt

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: SANLGGVPSKRLKMQYATGPLLKFQICVSSGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-195aa

Sequence Info: Full Length of Mature Protein

MW: 24.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Selenoprotein with thioredoxin reductase-like oxidoreductase activity (By similarity). Protects dopaminergic neurons against oxidative stress ans cell death

Involvement in disease:

Subcellular Location: Endoplasmic reticulum membrane, Single-pass membrane protein

Protein Families: SelWTH family, Selenoprotein T subfamily

Tissue Specificity: Ubiquitous. Highly expressed in the endocrine pancreas (PubMed:23913443). Expressed at low levels in the adult brain (PubMed:26866473).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P62342

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose