Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) | CSB-YP887432MO

(No reviews yet) Write a Review
SKU:
CSB-YP887432MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$406.80 - $1,614.00

Description

Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) | CSB-YP887432MO | Cusabio

Alternative Name(s): Endoplasmic reticulum resident protein 19 Short name: ER protein 19 Short name: ERp19 Thioredoxin-like protein p19

Gene Names: Txndc12

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-170aa

Sequence Info: Full Length of Mature Protein

MW: 18.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Possesses significant protein thiol-disulfide oxidase activity.

Reference: "ERp19 and ERp46, new members of the thioredoxin family of endoplasmic reticulum proteins."Knoblach B., Keller B.O., Groenendyk J., Aldred S., Zheng J., Lemire B.D., Li L., Michalak M.Mol. Cell. Proteomics 2:1104-1119(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Possesses significant protein thiol-disulfide oxidase activity.

Involvement in disease:

Subcellular Location: Endoplasmic reticulum lumen

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9CQU0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose