Cusabio Mouse Recombinants
Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) | CSB-EP887432MO
- SKU:
- CSB-EP887432MO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) | CSB-EP887432MO | Cusabio
Alternative Name(s): Endoplasmic reticulum resident protein 19 Short name: ER protein 19 Short name: ERp19 Thioredoxin-like protein p19
Gene Names: Txndc12
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 25-170aa
Sequence Info: Full Length of Mature Protein
MW: 20.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Possesses significant protein thiol-disulfide oxidase activity.
Reference: "ERp19 and ERp46, new members of the thioredoxin family of endoplasmic reticulum proteins."Knoblach B., Keller B.O., Groenendyk J., Aldred S., Zheng J., Lemire B.D., Li L., Michalak M.Mol. Cell. Proteomics 2:1104-1119(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Possesses significant protein thiol-disulfide oxidase activity.
Involvement in disease:
Subcellular Location: Endoplasmic reticulum lumen
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9CQU0
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A