Recombinant Mouse Tenascin (Tnc), partial | CSB-YP768917MO

(No reviews yet) Write a Review
SKU:
CSB-YP768917MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse Tenascin (Tnc), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €1,345.00

Description

Recombinant Mouse Tenascin (Tnc), partial | CSB-YP768917MO | Cusabio

Alternative Name(s): Hexabrachion (Tenascin-C) (TN-C) (Hxb)

Gene Names: Tnc

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1884-2099aa

Sequence Info: Partial

MW: 26.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells

Reference: "Amino acid sequence of mouse tenascin and differential expression of two tenascin isoforms during embryogenesis." Weller A., Beck S., Ekblom P. J. Cell Biol. 112:355-362(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8

Involvement in disease:

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Tenascin family

Tissue Specificity: Expressed in kidney, aortic valve, corneal limbus, periosteum around the ribs, cerebellum, stomach and intestine (PubMed:14709716). High levels of isoform 2 in lung and brain of newborn mice. High levels of isoform 5 in thymus, moderate levels in brain of newborn and adult mice. Low level of isoform 2 in adult brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q80YX1

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose