Recombinant Human Tenascin (TNC), partial | CSB-RP115094h(C)

(No reviews yet) Write a Review
SKU:
CSB-RP115094h(C)
Availability:
3 - 7 Working Days
  • Recombinant Human Tenascin (TNC), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €527.00

Description

Recombinant Human Tenascin (TNC), partial | CSB-RP115094h(C) | Cusabio

Alternative Name(s): Cytotactin;GMEMGP 150-225Glioma-associated-Extracellular domain matrix antigenHexabrachionJIMyotendinous antigenNeuronectin;Tenascin-C ;TN-C

Gene Names: TNC

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1888-2201aa

Sequence Info: Partial

MW: 39.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Extracellular domain matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6.

Reference: An alternatively spliced region of the human hexabrachion contains a repeat of potential N-glycosylation sites.Gulcher J.R., Nies D.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 86:1588-1592(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells

Involvement in disease: Deafness, autosomal dominant, 56 (DFNA56)

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Tenascin family

Tissue Specificity:

Paythway: PI3K-Aktsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P24821

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose