Recombinant Mouse Stromal cell-derived factor 2 (Sdf2) | CSB-EP020900MO

(No reviews yet) Write a Review
SKU:
CSB-EP020900MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Stromal cell-derived factor 2 (Sdf2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Stromal cell-derived factor 2 (Sdf2) | CSB-EP020900MO | Cusabio

Alternative Name(s): Sdf2; Stromal cell-derived factor 2; SDF-2

Gene Names: Sdf2

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 19-211aa

Sequence Info: Full Length of Mature Protein

MW: 26.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Isolation and characterization of a novel secretory protein, stromal cell-derived factor-2 (SDF-2) using the signal sequence trap method." Hamada T., Tashiro K., Tada H., Inazawa J., Shirozu M., Shibahara K., Nakamura T., Martina N., Nakano T., Honjo T.Gene 176:211-214(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Ubiquitously expressed with highest expression in liver and kidney.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9DCT5

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose