Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) | CSB-YP884158MO

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) | CSB-YP884158MO | Cusabio

Alternative Name(s): Sdf2l1; Stromal cell-derived factor 2-like protein 1; SDF2-like protein 1

Gene Names: Sdf2l1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

Expression Region: 29-211aa

Sequence Info: Full Length of Mature Protein

MW: 24.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Murine and human SDF2L1 is an endoplasmic reticulum stress-inducible gene and encodes a new member of the Pmt/rt protein family." Fukuda S., Sumii M., Masuda Y., Takahashi M., Koike N., Teishima J., Yasumoto H., Itamoto T., Asahara T., Dohi K., Kamiya Biochem. Biophys. Res. Commun. 280:407-414(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Endoplasmic reticulum lumen

Protein Families:

Tissue Specificity: Ubiquitously expressed with high expression in the testis, ovary, uterus, and low expression in heart and skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9ESP1

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A