Recombinant Mouse Single Ig IL-1-related receptor (Sigirr), partial | CSB-EP888356MO

Recombinant Mouse Single Ig IL-1-related receptor (Sigirr), partial | CSB-EP888356MO | Cusabio

Alternative Name(s): Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name: TIR8

Gene Names: Sigirr

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-117aa

Sequence Info: Partial

MW: 28.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity).

Reference: "Intestinal inflammation in mice deficient in Tir8, an inhibitory member of the IL-1 receptor family."Garlanda C., Riva F., Polentarutti N., Buracchi C., Sironi M., De Bortoli M., Muzio M., Bergottini R., Scanziani E., Vecchi A., Hirsch E., Mantovani A.Proc. Natl. Acad. Sci. U.S.A. 101:3522-3526(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity).

Involvement in disease:

Subcellular Location: Membrane, Single-pass type III membrane protein

Protein Families: Interleukin-1 receptor family

Tissue Specificity: Expressed at high levels in kidney, and at moderate levels in colon, small intestine, lung, spleen and liver. Not expressed in brain and muscle. Expressed at high levels in epithelial cells, at moderate levels in splenocytes, and at low or undetectable levels in fibroblasts or endothelial cells. Expressed in mucosal and dendritic cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9JLZ8

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A