Recombinant Mouse Serum amyloid A-3 protein (Saa3) | CSB-EP361411MO

Recombinant Mouse Serum amyloid A-3 protein (Saa3) | CSB-EP361411MO | Cusabio

Alternative Name(s): Saa3; Serum amyloid A-3 protein

Gene Names: Saa3

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-122aa

Sequence Info: Full Length of Mature Protein

MW: 15.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.

Reference: The sequence and structure of a new serum amyloid A gene.Stearman R.S., Lowell C.A., Peltzman C.G., Morrow J.F.Nucleic Acids Res. 14:797-809(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Major acute phase reactant. Apolipoprotein of the HDL complex.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: SAA family

Tissue Specificity: Found in various tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04918

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A