Recombinant Mouse Serum amyloid A-1 protein (Saa1) | CSB-EP020656MO

(No reviews yet) Write a Review
SKU:
CSB-EP020656MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Serum amyloid A-1 protein (Saa1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Mouse Serum amyloid A-1 protein (Saa1) | CSB-EP020656MO | Cusabio

Alternative Name(s): Saa1; Serum amyloid A-1 protein

Gene Names: Saa1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-122aa

Sequence Info: Full Length of Mature Protein

MW: 27.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Major acute phase protein

Reference: "Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences."Yamamoto K., Migita S.Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Major acute phase protein.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: SAA family

Tissue Specificity: Detected in blood plasma (at protein level). Detected in liver.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05366

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose