Cusabio Mouse Recombinants
Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1) | CSB-YP362579MO
- SKU:
- CSB-YP362579MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1) | CSB-YP362579MO | Cusabio
Alternative Name(s): P12;Prostatic secretory glycoprotein
Gene Names: Spink1
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24-80aa
Sequence Info: Full Length of Mature Protein
MW: 8.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa.
Reference: A secretory protease inhibitor requires androgens for its expression in male sex accessory tissues but is expressed constitutively in pancreas.Mills J.S., Needham M., Parker M.G.EMBO J. 6:3711-3717(1987)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Serine protease inhibitor which exhibits anti-trypsin activity
Involvement in disease:
Subcellular Location: Secreted
Protein Families:
Tissue Specificity: In the genital tract, expressed only in male accessory glands including seminal vesicle, coagulating gland and prostate.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P09036
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A