Recombinant Mouse Serine protease inhibitor A3N (Serpina3n) | CSB-EP835578MO(M)

(No reviews yet) Write a Review
SKU:
CSB-EP835578MO(M)
Availability:
3 - 7 Working Days
  • Recombinant Mouse Serine protease inhibitor A3N (Serpina3n)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Serine protease inhibitor A3N (Serpina3n) | CSB-EP835578MO(M) | Cusabio

Alternative Name(s): Serpina3n; Spi2; Serine protease inhibitor A3N; Serpin A3N

Gene Names: Serpina3n

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-418aa

Sequence Info: Full Length of Mature Protein

MW: 60.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Isolation of two cDNAs encoding novel alpha-1-antichymotrypsin-like proteins in a murine chondrocytic cell line.Inglis J.D., Lee M., Davidson D.R., Hill R.E.Gene 106:213-220(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Serpin family

Tissue Specificity: Expressed at high levels in brain, heart, liver, lung, spleen, testis and thymus, and at low levels in bone marrow, kidney and skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q91WP6

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose