Recombinant Mouse Serine protease 29 (Prss29) | CSB-EP859566MO(M)

Recombinant Mouse Serine protease 29 (Prss29) | CSB-EP859566MO(M) | Cusabio

Alternative Name(s): Implantation serine proteinase 2 ;ISP-2Strypsin-2Strypsin-related protein;Tryptase-like proteinase

Gene Names: Prss29

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDAGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 18-279aa

Sequence Info: Full Length of Mature Protein

MW: 43.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in bryo hatching and implantation.

Reference: Embryonic hatching enzyme strypsin/ISP1 is expressed with ISP2 in endometrial glands during implantation.O'Sullivan C.M., Liu S.Y., Karpinka J.B., Rancourt D.E.Mol. Reprod. Dev. 62:328-334(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in embryo hatching and implantation.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S1 family

Tissue Specificity: Expressed in embryos and placenta. Found in uterus especially in glandular epithelium during zona lysis and implantation.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99MS4

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A