Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2) | CSB-EP846028MO

Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2) | CSB-EP846028MO | Cusabio

Alternative Name(s): Pneumo secretory protein 1

Gene Names: Scgb3a2

Research Areas: Epigenetics and Nuclear Signaling

Organism: Mus musculus (Mouse)

AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 22-139aa

Sequence Info: Full Length of Mature Protein of Isoform C

MW: 43.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Enzyme and pathway databases

Reference: "UGRP1, a uteroglobin/Clara cell secretory protein-related protein, is a novel lung-enriched downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor."Niimi T., Keck-Waggoner C.L., Popescu N.C., Zhou Y., Levitt R.C., Kimura S.Mol. Endocrinol. 15:2021-2036(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Secreted cytokine-like protein (By similarity). Binds to the scavenger receptor MARCO (By similarity). Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast (By similarity). Strongly inhibits phospholipase A2 (PLA2G1B) activity

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Secretoglobin family, UGRP subfamily

Tissue Specificity: Highly expressed in lung where it localizes to epithelial cells of the trachea, bronchus and bronchioles (at protein level) (PubMed:11682631, PubMed:12406855, PubMed:12175512, PubMed:25242865). Expressed in club/Clara cells of the bronchioles (PubMed:12406855). Also detected in the anterior and posterior lobes of the pituitary gland where it may localize to gonadotropic cells (at protein level) (PubMed:24514953). Not detected in other tissues tested (PubMed:11682631, PubMed:12175512).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q920H1

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A