Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1) | CSB-EP755514MO

(No reviews yet) Write a Review
SKU:
CSB-EP755514MO
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1) | CSB-EP755514MO | Cusabio

Alternative Name(s): Secretoglobin RYD5 (Ryd5)

Gene Names: Scgb1c1

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-95aa

Sequence Info: Full Length of Mature Protein

MW: 21.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "A conditional knockout resource for the genome-wide study of mouse gene function." Skarnes W.C., Rosen B., West A.P., Koutsourakis M., Bushell W., Iyer V., Mujica A.O., Thomas M., Harrow J., Cox T., Jackson D., Severin J., Biggs P., Fu J., Nefedov M., de Jong P.J., Stewart A.F., Bradley A. Nature 474:337-342(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Secretoglobin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q7M742

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose