Cusabio Mouse Recombinants
Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1) | CSB-EP755514MO
- SKU:
- CSB-EP755514MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1) | CSB-EP755514MO | Cusabio
Alternative Name(s): Secretoglobin RYD5 (Ryd5)
Gene Names: Scgb1c1
Research Areas: Cancer
Organism: Mus musculus (Mouse)
AA Sequence: EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 24-95aa
Sequence Info: Full Length of Mature Protein
MW: 21.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance:
Reference: "A conditional knockout resource for the genome-wide study of mouse gene function." Skarnes W.C., Rosen B., West A.P., Koutsourakis M., Bushell W., Iyer V., Mujica A.O., Thomas M., Harrow J., Cox T., Jackson D., Severin J., Biggs P., Fu J., Nefedov M., de Jong P.J., Stewart A.F., Bradley A. Nature 474:337-342(2011)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Secretoglobin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q7M742
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A