Cusabio Mouse Recombinants
Recombinant Mouse Secreted phosphoprotein 24 (Spp2) | CSB-EP816975MO
- SKU:
- CSB-EP816975MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Secreted phosphoprotein 24 (Spp2) | CSB-EP816975MO | Cusabio
Alternative Name(s): Spp-24;Secreted phosphoprotein 2
Gene Names: Spp2
Research Areas: Cell Biology
Organism: Mus musculus (Mouse)
AA Sequence: FPVYDYDPSSLQEALSASVAKVNSQSLSPYLFRATRSSLKRVNVLDEDTLVMNLEFSVQETTCLRDSGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCRWASSSESNSSEEMMFGDMARSHRRRNDYLLGFLSDESRSEQFRDRSLEIMRRGQPPAHRRFLNLHRRARVNSGFE
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 24-203aa
Sequence Info: Full Length of Mature Protein
MW: 28 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Could coordinate an aspect of bone turnover.
Reference: "Carboxy terminus of secreted phosphoprotein-24 kDa (spp24) is essential for full inhibition of BMP-2 activity." Brochmann E.J., Simon R.J., Jawien J., Behnam K., Sintuu C., Wang J.C., Murray S.S. J Orthop Res 28:1200-1207(2010)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8K1I3
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A