Recombinant Mouse Resistin (Retn) | CSB-EP019573MO

(No reviews yet) Write a Review
SKU:
CSB-EP019573MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Resistin (Retn)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Resistin (Retn) | CSB-EP019573MO | Cusabio

Alternative Name(s): Adipose tissue-specific secretory factor ;ADSFAdipose-specific cysteine-rich secreted protein A12-alpha;Cysteine-rich secreted protein FIZZ3

Gene Names: Retn

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-114aa

Sequence Info: Full Length of Mature Protein

MW: 14.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.

Reference: Disulfide-dependent multimeric assembly of resistin family hormones.Patel S.D., Rajala M.W., Rossetti L., Scherer P.E., Shapiro L.Science 304:1154-1158(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Resistin/FIZZ family

Tissue Specificity: Expressed in white but not brown adipose tissue in a variety of organs.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99P87

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose